Tesamorelin acetate
Per lot, hosted by the laboratory that ran the test. All tests →
- CAS
- 218949-48-5
- Molecular weight
- 5136 g/mol
- Salt form
- acetate
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
In stock
ProductUnitsPrice
10 mg lyophilized vial · In Vivo
Units9,130 −20 change since the last stock sync
$274/ 10
1 kits · $274
Units9,010 no change since the last stock sync
$274/ 10
1 kits · $274
Units5,730 −30 change since the last stock sync
$274/ 10
1 kits · $274